Analytical Data
-
Gene name
RHAG
- Application
-
Alternative Names
RHAG;RH50;Ammonium transporter Rh type A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q02094
-
Expression Region
1-409aa
-
AA Sequence
MRFTFPLMAIVLEIAMIVLFGLFVEYETDQTVLEQLNITKPTDMGIFFELYPLFQDVHVMIFVGFGFLMTFLKKYGFSSVGINLLVAALGLQWGTIVQGILQSQGQKFNIGIKNMINADFSAATVLISFGAVLGKTSPTQMLIMTILEIVFFAHNEYLVSEIFKASDIGASMTIHAFGAYFGLAVAGILYRSGLRKGHENEESAYYSDLFAMIGTLFLWMFWPSFNSAIAEPGDKQCRAIVNTYFSLAACVLTAFAFSSLVEHRGKLNMVHIQNATLAGGVAVGTCADMAIHPFGSMIIGSIAGMVSVLGYKFLTPLFTTKLRIHDTCGVHNLHGLPGVVGGLAGIVAVAMGASNTSMAMQAAALGSSIGTAVVGGLMTGLILKLPLWGQPSDQNCYDDSVYWKVPKTR
-
Molecular Weight
44.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RHAG (Rhesus-associated glycoprotein) is a crucial protein embedded in the red blood cell membrane that plays a significant role in the transport of ammonia and other small molecules. It is primarily known for its involvement in the regulation of acid-base balance in the body and has garnered attention due to its association with the Rh blood group system. Mutations in RHAG can lead to various blood disorders and an incomplete Rh phenotype, highlighting its importance in transfusion medicine and hematology. Recent studies have focused on the biophysical properties, structural characteristics, and functional implications of RHAG, particularly in relation to its ability to facilitate ammonia transport across cell membranes. Researchers are employing recombinant DNA technology to produce RHAG in a controlled environment, allowing for detailed analysis of its structural and functional dynamics. Understanding the mechanisms by which RHAG operates not only enhances our knowledge of blood group antigens but also has potential therapeutic implications for managing conditions linked to its dysfunction. Such insights could pave the way for novel approaches to blood transfusion and treatment strategies for associated disorders.











