Analytical Data
-
Gene name
PMF1-BGLAP
- Application
-
Alternative Names
;
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
U3KQ54
-
Expression Region
1-211aa
-
AA Sequence
MAEASSANLGSGCEEKRHEGSSSESVPPGTTISRVKLLDTMVDTFLQKLVAAGSYQRFTDCYKCFYQLQPAMTQQIYDKFIAQLQTSIREEISDIKEEGNLEAVLNALDKIVEEGKVRKEPAWRPSGIPEKDLHSVMAPYFLQQRDTLRRHVQKQEAENQQLADAVLAGRRQVEELQLQVQAQQQAWQVRSPAVQSPAKVQPLCPSRRAAR
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The research on the PMF1-BGLAP recombinant protein stems from the increasing interest in understanding the molecular mechanisms underlying bone metabolism and mineralization. PMF1 (Pseudomonas Methylmalonyl-CoA mutase Family 1) has been shown to play a crucial role in regulating osteoblast differentiation and function, while BGLAP (Bone Gla Protein) is a key player in bone mineralization and calcium homeostasis. The interaction between these two proteins could provide valuable insights into the pathways that govern bone health and development. Previous studies have indicated that dysregulation of osteogenic proteins can lead to various bone-related disorders, such as osteoporosis and fractures. Therefore, the production of a recombinant PMF1-BGLAP fusion protein enables researchers to explore the functional characteristics and potential therapeutic applications of these proteins in bone regeneration. Such studies are essential for advancing our knowledge of skeletal biology and for developing novel treatments to combat bone diseases. Through techniques like protein expression, purification, and functional assays, scientists aim to elucidate the interaction mechanisms of PMF1 and BGLAP, potentially leading to breakthroughs in regenerative medicine and the enhancement of bone repair strategies.
