Analytical Data
-
Gene name
Crh
- Application
-
Alternative Names
Crh;CRFR;CRFR1;CRHR;Corticotropin-releasing factor receptor 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8CIT0
-
Expression Region
145-185aa
-
AA Sequence
SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII
-
Molecular Weight
20.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CRH (Corticotropin-Releasing Hormone) is a pivotal neuropeptide involved in the regulation of the stress response, governing the hypothalamic-pituitary-adrenal (HPA) axis. It plays a crucial role in the body's reaction to stress by stimulating the secretion of adrenocorticotropic hormone (ACTH) from the anterior pituitary gland, which subsequently promotes cortisol production from the adrenal glands. Research on recombinant CRH proteins has gained momentum due to their potential therapeutic applications in mood disorders, anxiety, and stress-related conditions. The recombinant production of CRH allows for the detailed study of its structure-function relationships, enabling researchers to investigate its interactions with specific receptors and downstream signaling pathways. Additionally, understanding the molecular dynamics of CRH can facilitate the development of targeted pharmacological agents that modulate its activity, providing a promising avenue for innovative treatments. As therapeutic targets expand, the recombinant technology also enables the exploration of CRH analogs that could offer greater specificity and reduced side effects. In light of the rising prevalence of stress-related conditions and the complex interplay of neuroendocrine factors, the study of CRH and its recombinant forms is of significant importance in both basic and clinical research settings, paving the way for advanced interventions in psychosomatic health management.











