Cat: PA2000-5134

Recombinant Human Crh Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Crh

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Crh;CRFR;CRFR1;CRHR;Corticotropin-releasing factor receptor 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8CIT0

  • Expression Region

    145-185aa

  • AA Sequence

    SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII

  • Molecular Weight

    20.1 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CRH (Corticotropin-Releasing Hormone) is a pivotal neuropeptide involved in the regulation of the stress response, governing the hypothalamic-pituitary-adrenal (HPA) axis. It plays a crucial role in the body's reaction to stress by stimulating the secretion of adrenocorticotropic hormone (ACTH) from the anterior pituitary gland, which subsequently promotes cortisol production from the adrenal glands. Research on recombinant CRH proteins has gained momentum due to their potential therapeutic applications in mood disorders, anxiety, and stress-related conditions. The recombinant production of CRH allows for the detailed study of its structure-function relationships, enabling researchers to investigate its interactions with specific receptors and downstream signaling pathways. Additionally, understanding the molecular dynamics of CRH can facilitate the development of targeted pharmacological agents that modulate its activity, providing a promising avenue for innovative treatments. As therapeutic targets expand, the recombinant technology also enables the exploration of CRH analogs that could offer greater specificity and reduced side effects. In light of the rising prevalence of stress-related conditions and the complex interplay of neuroendocrine factors, the study of CRH and its recombinant forms is of significant importance in both basic and clinical research settings, paving the way for advanced interventions in psychosomatic health management.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US