Analytical Data
-
Gene name
MGST3
- Application
-
Alternative Names
MGST3; Microsomal glutathione S-transferase 3; Microsomal GST-3; Glutathione peroxidase MGST3; LTC4 synthase MGST3; Microsomal glutathione S-transferase III; Microsomal GST-III
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O14880
-
Expression Region
1-152 aa
-
AA Sequence
MAVLSKEYGFVLLTGAASFIMVAHLAINVSKARKKYKVEYPIMYSTDPENGHIFNCIQRAHQNTLEVYPPFLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGEPSKRSRGALGSIALLGLVGTTVCSAFQHLGWVKSGLGSGPKCCH
-
Molecular Weight
42.46 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MGST3, or microsomal glutathione S-transferase 3, is a crucial enzyme that plays a significant role in cellular detoxification processes by catalyzing the conjugation of glutathione to various electrophilic compounds, thereby enhancing their solubility and facilitating their elimination from the body. The interest in MGST3 arises from its involvement in the metabolism of a wide range of substances, including drugs and environmental toxins, making it a pivotal protein in pharmacology and toxicology. Research has indicated that MGST3 is implicated in protecting cells from oxidative stress and may have therapeutic implications in diseases linked to oxidative damage, such as neurodegenerative disorders and cancer. Furthermore, understanding the structural and functional characteristics of MGST3 can provide insights into its enzymatic mechanisms and interactions with substrates. The recombinant expression of MGST3 allows for in-depth biochemical studies and potential applications in drug development, as it aids in the assessment of how various compounds are metabolized and cleared. As the prevalence of drug-resistant diseases rises, the role of MGST3 in drug metabolism becomes increasingly relevant, opening up avenues for personalized medicine that considers individual variations in MGST3 activity. Overall, the study of MGST3 as a recombinant protein not only sheds light on its fundamental biological functions but also holds promise for advancements in therapeutic strategies aimed at mitigating the effects of toxic exposures and optimizing pharmacological interventions.
