Cat: PA1000-2395

Recombinant Human PIM2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PIM2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PIM2;Serine/threonine-Protein kinase pim-2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9P1W9

  • Expression Region

    1-311aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMLTKPLQGPPAPPGTPTPPPGGKDREA FEAEYRLGPLLGKGGFGTVFAGHRLTDRLQVAIKVIPRNRVLGWSPLSDS VTCPLEVALLWKVGAGGGHPGVIRLLDWFE TQEGFMLVLERPLPAQDLFDYITEKGPLGEGPSRCFFGQVVAAIQHCHSR GVVHRDIKDENILIDLRRGCAKLIDFGSGALLHDEPYTDFDGTRVYSPPE WISRHQYHALPATVWSLGILLYDMVCGDIPFERDQEILEAELHFPAHVSP DCCALIRRCLAPKPSSRPSLEEILLDPWMQTPAEDVPLNPSKGGPAPLAW SLLP

  • Molecular Weight

    37 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PIM2, a member of the Pim kinase family, plays a crucial role in various cellular processes, including cell survival, proliferation, and differentiation. Its activity has been implicated in several types of cancers, making it a significant target for therapeutic intervention. The interest in PIM2 recombinant protein research has surged due to its involvement in oncogenic signaling pathways and its potential as a biomarker for cancer prognosis. Researchers have been exploring the structural and functional properties of PIM2, aiming to characterize its enzymatic activities and regulatory mechanisms. The production of recombinant PIM2 protein allows for detailed studies on its interaction with substrates and inhibitors, facilitating the identification of small molecules that can selectively inhibit its activity. Furthermore, understanding the role of PIM2 in cancer biology could lead to novel treatment strategies that disrupt its function, potentially improving patient outcomes. As cancer remains a leading cause of mortality worldwide, ongoing investigations into PIM2 and its pathways are essential for developing effective therapeutic agents and enhancing our understanding of tumorigenesis.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US