Analytical Data
-
Gene name
tat
- Application
-
Alternative Names
tat;Protein Tat
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A0A0H4LW18
-
Expression Region
1-103aa
-
AA Sequence
MEPVDPNLEPWNHPGSQPKTACNTCYCKKCCWHCQICFLKKGLGISYGRKKRKHRRGTPQSSKDHQHPIPKQSLPINRGRNPTDPKESKKKVASKAETDPCDL
-
Molecular Weight
15.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Tat, or Transactivator of Transcription, is a crucial regulatory protein encoded by the human immunodeficiency virus (HIV), which plays a pivotal role in enhancing viral gene expression and facilitating the replication of the virus within host cells. Research into Tat proteins has garnered significant attention owing to their unique structure and function, particularly their ability to translocate across cellular membranes and interact with various host cellular pathways. The exploration of Tat-recombinant proteins has opened new avenues in biomedical research, particularly in understanding HIV pathogenesis, latency, and the mechanisms of viral persistence in infected individuals. Additionally, Tat proteins have been employed as vehicles for drug delivery and vaccine development due to their inherent cellular penetrating capabilities. Studies focusing on Tat's interactions with host cell factors have revealed insights into immune evasion strategies employed by HIV, underscoring the importance of these proteins in viral pathobiology. Furthermore, advancements in recombinant DNA technology have paved the way for the production of Tat-based fusion proteins, which can serve as valuable tools in the study of protein-protein interactions and in the development of novel therapeutic strategies against HIV. Overall, the continuous investigation of Tat-recombinant proteins not only enhances our understanding of HIV biology but also holds promise for developing innovative approaches to combat viral infections and improve therapeutic outcomes.











