Cat: PA2000-5105

Recombinant Human tat Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    tat

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    tat;Protein Tat

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    A0A0H4LW18

  • Expression Region

    1-103aa

  • AA Sequence

    MEPVDPNLEPWNHPGSQPKTACNTCYCKKCCWHCQICFLKKGLGISYGRKKRKHRRGTPQSSKDHQHPIPKQSLPINRGRNPTDPKESKKKVASKAETDPCDL

  • Molecular Weight

    15.8 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Tat, or Transactivator of Transcription, is a crucial regulatory protein encoded by the human immunodeficiency virus (HIV), which plays a pivotal role in enhancing viral gene expression and facilitating the replication of the virus within host cells. Research into Tat proteins has garnered significant attention owing to their unique structure and function, particularly their ability to translocate across cellular membranes and interact with various host cellular pathways. The exploration of Tat-recombinant proteins has opened new avenues in biomedical research, particularly in understanding HIV pathogenesis, latency, and the mechanisms of viral persistence in infected individuals. Additionally, Tat proteins have been employed as vehicles for drug delivery and vaccine development due to their inherent cellular penetrating capabilities. Studies focusing on Tat's interactions with host cell factors have revealed insights into immune evasion strategies employed by HIV, underscoring the importance of these proteins in viral pathobiology. Furthermore, advancements in recombinant DNA technology have paved the way for the production of Tat-based fusion proteins, which can serve as valuable tools in the study of protein-protein interactions and in the development of novel therapeutic strategies against HIV. Overall, the continuous investigation of Tat-recombinant proteins not only enhances our understanding of HIV biology but also holds promise for developing innovative approaches to combat viral infections and improve therapeutic outcomes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US