Analytical Data
-
Gene name
Rv3304
- Application
-
Alternative Names
Rv3304
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O53356
-
Expression Region
1-159aa
-
AA Sequence
MPLYAAYGSNMHPEQMLERAPHSPMAGTGWLPGWRLTFGGEDIGWEGALATVVEDPDSKVFVVLYDMTPADEKNLDRWEGSEFGIHQKIRCRVERISSDTTTDPVLAWLYVLDAWEGGLPSARYLGVMADAAEIAGAPSDYVHDLRTRPARNIGPGTIA
-
Molecular Weight
24.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The RV3304 protein, a recombinant protein derived from the bacterium *Mycobacterium tuberculosis*, has gained significant attention in recent years due to its potential role in understanding tuberculosis (TB) pathogenesis and immunity. Tuberculosis remains one of the leading causes of death from infectious diseases globally, primarily caused by *M. tuberculosis*. Research indicates that RV3304 may be involved in the bacteria's survival and pathogenic mechanisms, making it a crucial target for vaccine and therapeutic development. Studies have shown that RV3304 can elicit specific immune responses, suggesting its potential as a candidate for immunological assays or vaccine development. Furthermore, the protein's expression and purification in laboratory settings using recombinant DNA technology allow for in-depth biochemical characterization, which is essential for elucidating its function and interactions within the host immune system. Understanding the role of RV3304 may also contribute to the identification of novel biomarkers for TB diagnosis and the development of more effective interventions against this pervasive disease. Overall, ongoing research on RV3304 represents a promising avenue in the quest to combat TB and improve public health outcomes.
