Analytical Data
-
Gene name
PHPT1
- Application
-
Alternative Names
PHPT1;PHP14;14 kDa phosphohistidine phosphatase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NRX4
-
Expression Region
1-125aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMAVADLALIPDVDIDSDGVFKYVLIRVHSA PRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRIS HQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY
-
Molecular Weight
16 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PHPT1 (Phosphate Homeostasis Protein 1) is a recently identified protein that plays a crucial role in the regulation of phosphate levels within the body. Its significance stems from the essential function of phosphate in various biological processes, including cellular signaling, energy metabolism, and bone health. Dysregulation of phosphate homeostasis is associated with numerous health issues, such as cardiovascular diseases, bone disorders, and renal dysfunction. As the understanding of PHPT1’s structure and function evolves, researchers are increasingly interested in its potential as a therapeutic target and biomarker for related disorders. Recombining PHPT1 in laboratory settings allows scientists to elucidate its molecular mechanisms and interactions, paving the way for future studies into its role in pathophysiology. Additionally, this research may lead to innovative strategies for correcting phosphate imbalances, offering new avenues for treatment and enhancing our overall understanding of mineral metabolism. The exploration of PHPT1 and its recombinant forms represents a promising frontier in biomedical research.
