Analytical Data
-
Gene name
VACWR170
- Application
-
Alternative Names
VACWR170；3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P26670
-
Expression Region
1-346aa
-
AA Sequence
MAVYAVTGGAGFLGRYIVKLLISADDVQEIRVIDIVEDPQPITSKVKVINYIQCDINDFDKVREALDGVNLIIHTAALVDVFGKYTDNEIMKVNYYGTQTILAACVDLGIKYLIYTSSMEAIGPNKHGDPFIGHEHTLYDISPGHVYAKSKRMAEQLVMKANNSVIMNGAKLYTCCLRPTGIYGEGDKLTKVFYEQCKQHGNIMYRTVDDDAVHSRVYVGNVAWMHVLAAKYIQYPGSEIKGNAYFCYDYSPSCSYDMFNLLLMKPLGIEQGSRIPRWMLKMYACKNDMKRILFRKPSLLNNYTLKISNTTFEVRTNNAELDFNYSPIFNVDVAFERTRKWLEESE
-
Molecular Weight
46.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
VACWR170 is a recombinant protein that originates from the VACV (Vaccinia Virus) family, which is known for its role in viral pathogenesis and immune evasion. Research into VACWR170 is significant due to its potential applications in vaccine development and immunotherapy, particularly in the context of viral infections and cancer. Vaccinia virus, historically used as a live vaccine for smallpox, offers a robust platform for studying immune responses and developing novel therapeutic strategies. VACWR170, in particular, has garnered attention for its immunomodulatory properties, wherein it may influence host immune responses to augment antiviral or antitumor effects. Investigations have revealed that VACWR170 can manipulate host cell signaling pathways, thereby enhancing understanding of viral mechanisms of immune evasion and providing insights into the design of recombinant vaccines. Furthermore, studies on VACWR170 contribute to broader efforts in vaccine research, including the quest for more effective immunization strategies against various infectious diseases and malignancies. This recombinant protein serves as a valuable tool for deciphering complex host-pathogen interactions and may lead to innovative therapeutic approaches leveraging the host immune system. Overall, ongoing research on VACWR170 aims to bridge virology, immunology, and therapeutic development, with the ultimate goal of improving health outcomes through enhanced vaccine efficacy and targeted immunotherapies.
