Analytical Data
-
Gene name
PTPN14
- Application
-
Alternative Names
PTPN14；PEZ；PTPD2；Tyrosine-Protein phosphatase non-receptor type 14
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15678
-
Expression Region
1-189aa
-
AA Sequence
MPFGLKLRRTRRYNVLSKNCFVTRIRLLDSNVIECTLSVESTGQECLEAVAQRLELRETHYFGLWFLSKSQQARWVELEKPLKKHLDKFANEPLLFFGVMFYVPNVSWLQQEATRYQYYLQVKKDVLEGRLRCTLDQVIRLAGLAVQADFGDYNQFDSQDFLREYVLFPMDLALEEAVLEELTQKVAQE
-
Molecular Weight
29.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PTPN14 (Protein Tyrosine Phosphatase Non-Receptor Type 14) is a critical enzyme involved in various cellular processes, including signal transduction, cell proliferation, and differentiation. With its role as a negative regulator in several oncogenic pathways, PTPN14 has gained significant attention in cancer research. Alterations in its expression or activity have been linked to various malignancies, suggesting that it may function as a tumor suppressor. The study of recombinant PTPN14 protein is essential for understanding its biochemical properties, mechanisms of action, and its interactions with other cellular components. By producing PTPN14 in a recombinant system, researchers can investigate its phosphorylation state, binding partners, and regulatory mechanisms in a controlled environment. This approach not only aids in elucidating the protein's functional roles but also holds potential for therapeutic applications, particularly in the development of targeted cancer treatments. Overall, the research surrounding recombinant PTPN14 is crucial for uncovering its implications in cancer biology and advancing strategies for effective interventions.
