Analytical Data
-
Gene name
MEI1
- Application
-
Alternative Names
MEI1Meiosis inhibitor protein 1; Meiosis defective protein 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5TIA1
-
Expression Region
1-238aa
-
AA Sequence
MLALTLAKADSPRTALLCSAWLLTASFSAQQHKGSLQVHQTLSVEMDQVLKALSFPKKKAALLSAAILCFLRTALRQSFSSALVALVPSGAQPLPATKDTVLAPLRMSQVRSLVIGLQNLLVQKDPLLSQACVGCLEALLDYLDARSPDIALHVASQPWNRFLLFTLLDAGENSFLRPEILRLMTLLQSMGHLADHSMAQTLQASLEGLPPSTSSGQPPLQDMLCLGGVAVSLSHIRN
-
Molecular Weight
52 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MEI1 is a crucial protein involved in the regulation of meiotic recombination, a process essential for the formation of gametes in many organisms. In recent years, there has been a growing interest in understanding the molecular mechanisms underlying meiosis, particularly how meiotic recombination is orchestrated to ensure genetic diversity and stability. MEI1 has been identified as a key player in the assembly of the synaptonemal complex, which is vital for homologous chromosome pairing and recombination during meiosis. Its role in promoting the selection of homologous chromosomes and preventing inappropriate recombination events is critical for successful gametogenesis. Given the importance of reproductive success in both agriculture and conservation, research into MEI1 and its functional dynamics may provide insights into fertility issues, genetic disorders, and potential biotechnological applications in crop improvement. Recent studies have explored MEI1's interaction with other proteins and its regulation by post-translational modifications, shedding light on the intricate network that governs meiotic progression. Understanding MEI1's biochemical pathways will not only elucidate fundamental biological processes but also potentially lead to advancements in reproductive health and agricultural biotechnology by manipulating meiotic behavior for better yield and genetic outcomes.
