Analytical Data
-
Gene name
Klk1b5
- Application
-
Alternative Names
Klk1b5；Klk-5；Klk5；Kallikrein 1-related peptidase b5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P15945
-
Expression Region
25-261aa
-
AA Sequence
IFGGFNCEKNSQPWQVAVYRFTKYQCGGVLLNANWVLTAAHCHNDKYQVWLGKNNFFEDEPSAQHRLVSKAIPHPDFNMSLLNEHTPQPEDDYSNDLMLLRLKKPADITDVVKPIDLPTEEPKLGSTCLASGWGSITPVIYEPADDLQCVNFKLLPNEDCVKAHIEKVTDVMLCAGDMDGGKDTCMGDSGGPLICDGVLHGITSWGPSPCGKPNVPGIYTKLIKFNSWIKDTIAKNA
-
Molecular Weight
39.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Klk1b5, a member of the kallikrein-related peptidase family, has garnered significant attention in recent years due to its potential implications in various physiological and pathological processes. This serine protease is predominantly expressed in the prostate and has been linked to reproductive functions, as well as being implicated in cancer biology, particularly prostate cancer. Research suggests that Klk1b5 may play a role in extracellular matrix remodeling and modulation of cell signaling, which can influence tumor progression and metastasis. Its expression levels have been associated with tumorigenesis and serve as a potential biomarker for prostate cancer diagnosis and prognosis. The recombinant expression of Klk1b5 allows for the study of its enzymatic properties and biological functions in detail, facilitating investigations into its role in disease mechanisms. Furthermore, understanding the structure-function relationship of Klk1b5 can aid in the development of targeted therapeutic strategies. By elucidating the biochemical and molecular characteristics of this protein, researchers aim to unlock its potential as a diagnostic tool and therapeutic target in cancer treatment, making Klk1b5 a crucial focus in the field of cancer research and proteomics.
