Cat: PA2000-9249

Recombinant Human MED22 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MED22

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    MED22; SURF5Mediator of RNA polymerase II transcription subunit 22; Mediator complex subunit 22; Surfeit locus protein 5; Surf-5

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q15528

  • Expression Region

    1-140aa

  • AA Sequence

    MAQQRALPQSKETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAIDQRNQQLRTLQEECDRKLITLRDEISIDLYELEEEYYSSRYK

  • Molecular Weight

    42.9 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MED22, a subunit of the Mediation complex, plays a crucial role in the regulation of gene expression by serving as a bridge between transcription factors and the RNA polymerase II machinery. As a component of the Mediator complex, which is essential for transcriptional regulation of protein-coding genes, MED22 is involved in various cellular processes, including cell differentiation, proliferation, and response to external stimuli. Recent studies have highlighted MED22's involvement in several biological pathways, linking it to various diseases, including cancer and neurodegenerative disorders. Given its pivotal role in gene regulation, researchers are increasingly interested in understanding the molecular mechanisms underlying MED22 function. This includes the elucidation of its structural properties, interaction with other Mediator components, and the identification of its target genes. Furthermore, the elucidation of MED22's role in specific pathways may provide insights into its potential as a therapeutic target. The production of recombinant MED22 protein is essential for such studies as it allows for in-depth biochemical analyses and functional assays, aiding in the characterization of its role in transcription regulation. Overall, the research on MED22 not only enhances our understanding of transcriptional control but also opens avenues for therapeutic approaches in diseases associated with its dysfunction.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US