Analytical Data
-
Gene name
MED22
- Application
-
Alternative Names
MED22; SURF5Mediator of RNA polymerase II transcription subunit 22; Mediator complex subunit 22; Surfeit locus protein 5; Surf-5
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15528
-
Expression Region
1-140aa
-
AA Sequence
MAQQRALPQSKETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAIDQRNQQLRTLQEECDRKLITLRDEISIDLYELEEEYYSSRYK
-
Molecular Weight
42.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MED22, a subunit of the Mediation complex, plays a crucial role in the regulation of gene expression by serving as a bridge between transcription factors and the RNA polymerase II machinery. As a component of the Mediator complex, which is essential for transcriptional regulation of protein-coding genes, MED22 is involved in various cellular processes, including cell differentiation, proliferation, and response to external stimuli. Recent studies have highlighted MED22's involvement in several biological pathways, linking it to various diseases, including cancer and neurodegenerative disorders. Given its pivotal role in gene regulation, researchers are increasingly interested in understanding the molecular mechanisms underlying MED22 function. This includes the elucidation of its structural properties, interaction with other Mediator components, and the identification of its target genes. Furthermore, the elucidation of MED22's role in specific pathways may provide insights into its potential as a therapeutic target. The production of recombinant MED22 protein is essential for such studies as it allows for in-depth biochemical analyses and functional assays, aiding in the characterization of its role in transcription regulation. Overall, the research on MED22 not only enhances our understanding of transcriptional control but also opens avenues for therapeutic approaches in diseases associated with its dysfunction.
