Analytical Data
-
Gene name
Peroxiredoxin 2
- Application
-
Alternative Names
PRDX4;Peroxiredoxin-4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P32119
-
Expression Region
2-198aa
-
AA Sequence
ASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVC PTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNI PLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRS VDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN
-
Molecular Weight
22 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Peroxiredoxin 2 (Prx2) is a member of the peroxiredoxin family of antioxidant enzymes, which play crucial roles in cellular defense against oxidative stress. Research has shown that Prx2 is involved in various physiological processes, including cell proliferation, differentiation, and apoptosis, as well as in the regulation of redox signaling pathways. Its expression is highly regulated in response to different stimuli, such as oxidative stress and inflammatory signals. Given its importance in cellular homeostasis, Prx2 has been implicated in several diseases, including cancer, neurodegenerative disorders, and cardiovascular diseases. The study of recombinant Prx2 has gained momentum as it allows for the detailed investigation of its enzymatic activity, structural characteristics, and interactions with other proteins. By producing recombinant Prx2 through molecular cloning and expression in suitable host systems, researchers can study its functional properties and assess its potential as a therapeutic target or biomarker. Furthermore, understanding the mechanisms by which Prx2 protects against oxidative damage could lead to the development of novel strategies for disease prevention and treatment. The ongoing research into recombinant Prx2 highlights its significance in biomedical research, ultimately aiming to clarify its role in health and disease.
