Analytical Data
-
Gene name
tdh1
- Application
-
Alternative Names
tdh1；NIS；Sodium/iodide cotransporter
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P19249
-
Expression Region
25-189aa
-
AA Sequence
FELPSVPFPAPGSDEILFVVRDTTFNTQAPVNVKVSDFWTNRNVKRKPYEDVYGQSVFTTSGTKWLTSYMTVNINDKDYTMAAVSGYKSGHSAVFVKSGQVQLQHSYNSVANFVGEDEGSIPSKMYLDETPEYFVNVEAYESGSGNILVMCISNKESFFECKHQQ
-
Molecular Weight
26.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of TDH1 recombinant protein has gained significant attention in recent years, particularly in the field of biotechnology and therapeutic development. TDH1, or Thioredoxin-Dependent Hydrogenase 1, is a key enzyme involved in various cellular processes, including redox regulation, stress responses, and metabolic pathways. Its role in catalyzing the oxidation-reduction reactions makes it crucial for maintaining cellular homeostasis and responding to environmental stressors. Research into TDH1 has revealed its potential implications in various diseases, including cancer and metabolic disorders, where dysregulation of redox states can lead to pathological conditions. The advent of recombinant DNA technology has enabled the production of TDH1 in controlled laboratory settings, facilitating detailed studies of its structure, function, and interaction with other biomolecules. By elucidating the mechanisms by which TDH1 functions, researchers aim to uncover its therapeutic potential and explore its use as a biomarker for disease diagnosis and progression. Furthermore, the recombinant form of TDH1 could serve as a valuable tool in drug discovery and the development of novel therapeutic strategies. Overall, the ongoing research into TDH1 recombinant protein not only enhances our understanding of fundamental biological processes but also opens new avenues in the development of targeted interventions for various health conditions.
