Analytical Data
-
Gene name
D13L
- Application
-
Alternative Names
D13L；C21orf13；Lebercilin-like Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P68441
-
Expression Region
1-230aa
-
AA Sequence
MNNTIINSLIGGDDSIKRSNVFAVDSQIPTLYMPQYISLSGVMTNDGPDNQAIASFEIRDQYITALNHLVLSLELPEVKGMGRFGYVPYVGYKCINHVSISSCNGVIWEIEGEELYNNCINNTIALKHSGYSSELNDISIGLTPNDTIKEPSTVYVYIKTPFDVEDTFSSLKLSDSKITVTVTFNPVSDIVIRDSSFDFETFNKEFVYVPELSFIGYMVKNVQIKPSFIE
-
Molecular Weight
33.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The D13L protein, a member of the viral protein family, is a key focus in the study of viral pathogenesis and host interactions. Originating from the vaccinia virus, D13L plays an integral role in immune evasion, manipulating host defenses to promote viral replication. Research has shown that D13L can inhibit apoptosis in infected cells, enabling the virus to persist longer within the host. The protein's structure and function have been extensively analyzed, revealing its potential as a target for antiviral therapies. Investigations into D13L's interactions with host proteins and immune response pathways are crucial for understanding its role in viral life cycles and the broader implications for disease management. As scientists explore recombinant forms of D13L, they aim to uncover novel therapeutic strategies, leveraging the protein's ability to modulate immune responses and potentially provide insights into the development of more effective vaccines and treatments for various viral infections. This research not only deepens our understanding of D13L but also contributes to the broader field of virology and immunology, highlighting the importance of viral proteins in host-virus dynamics.
