Cat: PA1000-2332

Recombinant Human PECI Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PECI

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ECI2;DRS1;HCA88;PECI;Enoyl-CoA delta isomerase 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O75521

  • Expression Region

    31-394aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMNRTAMRASQKDFENSMNQVKLLKKDPGNE VKLKLYALYKQATEGPCNMPKPGVFDLINKAKWDAWNALGSLPKEAARQN YVDLVSSLSPSLESSSQVEPGTDRKSTGFETLVVTSEDGITKIMFNRPKK KNAINTEMYHEIMRALKAASKDDSIITVLTGNGDYYSSGNDLTNFTDIPP GGVEEKAKNNAVLLREFVGCFIDFPKPLIAVVNGPAVGISVTLLGLFDAV YASDRATFHTPFSHLGQSPEGCSSYTFPKIMSPAKATEMLIFGKKLTAGE ACAQGLVTEVFPDSTFQKEVWTRLKAFAKLPPNALRISKEVIRKREREKL HAVNAEECNVLQGRWLSDECTNAVVNFLSRKSKL

  • Molecular Weight

    42 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PECI (Peroxisomal Enzyme Catalase-Inducing Protein) is a novel protein that has garnered attention in the field of cellular biology and biochemistry due to its role in regulating peroxisomal enzyme activity and its potential implications in disease mechanisms. Research into PECI has revealed its involvement in the oxidative stress response, which is crucial for cell survival and function, especially in conditions associated with high levels of reactive oxygen species (ROS). As oxidative stress is linked to various pathologies, including neurodegenerative diseases, cancer, and metabolic disorders, understanding the molecular mechanisms and regulatory pathways involving PECI becomes essential. Studies have indicated that PECI can modulate the expression of catalase, an enzyme that protects cells from oxidative damage, thereby suggesting its potential as a therapeutic target. Furthermore, the exploration of PECI's interactions with other cellular components and signaling pathways may provide insights into its broader biological functions and its potential applications in enhancing cellular resilience against stressors. Overall, the investigation of PECI not only contributes to a deeper understanding of peroxisomal function and homeostasis but also opens new avenues for developing strategies to mitigate oxidative damage in various clinical contexts.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US