Analytical Data
-
Gene name
UL132
- Application
-
Alternative Names
UL132;Envelope glycoProtein UL132
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P69339
-
Expression Region
157-270aa
-
AA Sequence
SPYQRLETRDWDEEEEASAARERMKHDPENVIYFRKDGNLDTSFVNPNYGRGSPLTIESHLSDNEEDPIRYYVSVYDELTASEMEEPSNSTSWQIPKLMKVAMQPVSLRDPEYD
-
Molecular Weight
61.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
UL132 is a protein encoded by the human cytomegalovirus (HCMV), a member of the Herpesviridae family, which is known to establish lifelong latent infections in humans. Research on UL132 has gained significant attention due to its potential role in the virus's pathogenicity and immune evasion mechanisms. Studies indicate that UL132 impacts the host's immune response by modulating the activity of natural killer (NK) cells and influencing the expression of various immune-related genes. Its unique structural features suggest that UL132 may interact with host cell proteins, further complicating the host's immune recognition of the virus. Understanding the functional roles of UL132 is imperative, as it may offer insights into HCMV-mediated diseases, particularly in immunocompromised individuals, such as transplant recipients or those with HIV/AIDS. Additionally, UL132 may serve as a target for novel therapeutics and vaccine development, aimed at enhancing the immune system's ability to combat HCMV. As HCMV is a leading cause of congenital infections and significant morbidity in transplant patients, further elucidation of UL132's mechanisms and interactions remains a critical area of investigation in virology and immunology.











