Cat: PA2000-770DB

Recombinant Human SCRN1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SCRN1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SCRN1;KIAA0193;Secernin-1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q12765

  • Expression Region

    1-414aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMAAAPPSYCFVAFPPRAKDGLVVFGKN SARPRDEVQEVVYFSAADHEPESKVECTYISIDQVPRTYAIMISRPAWLW GAEMGANEHGVCIANEAINTREPAAEIEALLGMDLVRLGLERGETAKEAL DVIVSLLEEHGQGGNYFEDANSCHSFQSAYLIVDRDEAWVLETIGKYWAA EKVTEGVRCICSQLSLTTKMDAEHPELRSYAQSQGWWTGEGEFNFSEVFS PVEDHLDCGAGKDSLEKQEESITVQTMMNTLRDKASGVCIDSEFFLTTAS GVSVLPQNRSSPCIHYFTGTPDPSRSIFKPFIFVDDVKLVPKTQSPCFGD DDPAKKEPRFQEKPDRRHELYKAHEWARAIIESDQEQGRKLRSTMLELEK QGLEAMEEILTSSEPLDPAEVGDLFYDCVDTEIKFFK

  • Molecular Weight

    49 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SCRN1, also known as secretory carrier membrane protein 1, is a member of the secretory carrier membrane protein family, which plays a crucial role in the intracellular transport and processing of proteins. This protein is primarily involved in the sorting and trafficking of secretory vesicles, facilitating the delivery of various cargo proteins to their designated locations. Research on SCRN1 has gained attention due to its potential implications in neurodegenerative diseases and cellular stress responses. Alterations in SCRN1 expression and function have been linked to conditions such as Alzheimer's disease, where improper protein handling may contribute to the accumulation of toxic aggregates. Furthermore, SCRN1 has been implicated in the regulation of synaptic function and neuronal signaling, making it a candidate for understanding the underlying mechanisms of neuronal health and disease. The recombinant protein studies aim to elucidate SCRN1's molecular mechanisms, its interactions with other cellular components, and its potential as a therapeutic target. By generating and characterizing SCRN1 recombinant proteins, researchers can investigate their functional properties, which may lead to insights into novel intervention strategies for disorders associated with defective protein trafficking. Thus, the study of SCRN1 and its recombinant forms is essential for advancing our understanding of cellular biology and potential therapeutic avenues for neurodegenerative diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US