Analytical Data
-
Gene name
MCART2
- Application
-
Alternative Names
SLC25A52; MCART2; Mitochondrial nicotinamide adenine dinucleotide transporter SLC25A52; Mitochondrial NAD(+ transporter SLC25A52; Mitochondrial carrier triple repeat protein 2; Solute carrier family 25 member 52
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q3SY17
-
Expression Region
1-297aa
-
AA Sequence
MIDSEAHEKRPPILTSSKQDISPHITNVGEMKHYLCGCCAAFNNVAITYPIQKVLFRQQLYGIKTRDAVLQLRRDGFRNLYRGILPPLMQKTTTLALMFGLYEDLSCLLRKHVRAPEFATHGVAAVLAGTAEAIFTPLERVQTLLQNHKHHDKFTNTYQAFKALKCHGIGEYYRGLVPILFRNGLSNVLFFGLRGPIKEHLPTATTHSAHLVNDFIGGGLLGAMLGFLCFPINVVKTRIQSQIGGEFQSFPKVFQKIWLERDRKLINLFRGAHLNYHRSLISWGIINATYEFLLKFI
-
Molecular Weight
60.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MCART2, or the Mitochondrial Ca²⁺ Uniporter Regulator 2, is a recently discovered protein that plays a crucial role in the regulation of mitochondrial calcium homeostasis, which is vital for various cellular processes including energy metabolism and apoptosis. Research on MCART2 has gained momentum due to its potential implications in understanding diseases linked to mitochondrial dysfunction, such as neurodegenerative disorders and metabolic syndromes. Mitochondria are known as the powerhouses of the cell, and their ability to uptake calcium ions impacts ATP production and reactive oxygen species (ROS) generation. Dysregulation of calcium uptake can lead to excessive ROS production and subsequent cell damage. Consequently, elucidating the regulatory mechanisms of MCART2 could provide insights into how mitochondrial calcium dynamics are altered in pathological states. Current studies aim to characterize the molecular structure of MCART2 and its interactions with other mitochondrial proteins, as well as its functional consequences on mitochondrial physiology. Understanding the role of MCART2 in cell signaling and energy metabolism could pave the way for novel therapeutic strategies targeting mitochondrial dysfunction, highlighting its significance in both basic and applied biomedical research.
