Analytical Data
-
Gene name
MCART1
- Application
-
Alternative Names
SLC25A51; MCART1; Mitochondrial nicotinamide adenine dinucleotide transporter SLC25A51; Mitochondrial NAD(+ transporter SLC25A51; Mitochondrial carrier triple repeat protein 1; Solute carrier family 25 member 51
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H1U9
-
Expression Region
1-297aa
-
AA Sequence
MMDSEAHEKRPPILTSSKQDISPHITNVGEMKHYLCGCCAAFNNVAITFPIQKVLFRQQLYGIKTRDAILQLRRDGFRNLYRGILPPLMQKTTTLALMFGLYEDLSCLLHKHVSAPEFATSGVAAVLAGTTEAIFTPLERVQTLLQDHKHHDKFTNTYQAFKALKCHGIGEYYRGLVPILFRNGLSNVLFFGLRGPIKEHLPTATTHSAHLVNDFICGGLLGAMLGFLFFPINVVKTRIQSQIGGEFQSFPKVFQKIWLERDRKLINLFRGAHLNYHRSLISWGIINATYEFLLKVI
-
Molecular Weight
60.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MCART1 (Mitochondrial Carrier 1) is a protein primarily located in the mitochondria and is involved in various metabolic processes, including fatty acid metabolism and energy production. Research on MCART1 has gained attention due to its potential role in cellular energy homeostasis and implications in metabolic disorders, such as obesity and diabetes. Recombinant MCART1 proteins have been developed to investigate their functional properties, interaction with other mitochondrial proteins, and their impact on mitochondrial function. Understanding the structure and function of MCART1 can provide insights into the mechanisms of mitochondrial dysfunction and its associated diseases. Furthermore, studies involving MCART1 can lead to the identification of novel therapeutic targets for metabolic diseases, making it a significant focus within the fields of biochemistry and molecular biology. The generation of recombinant forms of MCART1 facilitates detailed biophysical and biochemical analyses, allowing researchers to dissect its role in mitochondrial dynamics and signaling pathways in a controlled environment.
