Analytical Data
-
Gene name
MC2R
- Application
-
Alternative Names
MRAP2; C6orf117; Melanocortin-2 receptor accessory protein 2; MC2R accessory protein 2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96G30
-
Expression Region
1-297aa
-
AA Sequence
MKHIINSYENINNTARNNSDCPRVVLPEEIFFTISIVGVLENLIVLLAVFKNKNLQAPMYFFICSLAISDMLGSLYKILENILIILRNMGYLKPRGSFETTADDIIDSLFVLSLLGSIFSLSVIAADRYITIFHALRYHSIVTMRRTVVVLTVIWTFCTGTGITMVIFSHHVPTVITFTSLFPLMLVFILCLYVHMFLLARSHTRKISTLPRANMKGAITLTILLGVFIFCWAPFVLHVLLMTFCPSNPYCACYMSLFQVNGMLIMCNAVIDPFIYAFRSPELRDAFKKMIFCSRYW
-
Molecular Weight
60.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of the MC2R (Melanocortin 2 receptor) recombinant protein is rooted in its critical role in the endocrine system, particularly in regulating adrenal function and response to stress. MC2R is primarily expressed in the adrenal cortex and is essential for mediating the effects of adrenocorticotropic hormone (ACTH), which stimulates cortisol production—an important hormone involved in metabolism, immune response, and stress adaptation. Dysregulation of this receptor is associated with various disorders, including adrenal insufficiency and obesity. By producing and characterizing recombinant MC2R proteins, researchers aim to deepen their understanding of the receptor's structural and functional dynamics, which can reveal insights into the mechanisms of hormone signaling and the pathophysiology of related diseases. The exploration of MC2R interactions with ligands and other signaling pathways can pave the way for the development of targeted therapies that address adrenal gland dysfunction and its systemic effects. Furthermore, the use of recombinant technology allows for the production of sufficient quantities of the MC2R protein for high-fidelity studies, including crystallography, binding assays, and pharmacological screenings, which can ultimately lead to novel therapeutic interventions.
