Analytical Data
-
Gene name
OPA3
- Application
-
Alternative Names
OPA3;Optic atrophy 3 Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H6K4
-
Expression Region
1-179aa
-
AA Sequence
MVVGAFPMAKLLYLGIRQVSKPLANRIKEAARRSEFFKTYICLPPAQLYH WVEMRTKMRIMGFRGTVIKPLNEEAAAELGAELLGEATIFIVGGGCLVLE YWRHQAQQRHKEEEQRAAWNALRDEVGHLALALEALQAQVQAAPPQGALE ELRTELQEVRAQLCNPGRSASHAVPASKK
-
Molecular Weight
19.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of OPA3 (Optic Atrophy 3) recombinant protein is pivotal in understanding mitochondrial function and its implications for neurodegenerative diseases. OPA3 is a gene located on chromosome 19, and mutations in this gene are associated with autosomal dominant optic atrophy, a condition characterized by vision loss due to the degeneration of the optic nerve. Research has shown that OPA3 plays a critical role in the maintenance of mitochondrial dynamics and function, including processes such as fusion, fission, and apoptosis. Given its significance in mitochondrial biology, OPA3 has garnered attention as a potential target for therapeutic interventions in diseases linked to mitochondrial dysfunction, such as Leber's hereditary optic neuropathy (LHON) and other hereditary optic neuropathies. The recombinant form of OPA3 allows for detailed studies into its structure-function relationship, biochemical properties, and interaction mechanisms with other mitochondrial proteins. By producing this protein in a controlled laboratory setting, researchers can investigate its role at the molecular level, as well as its impact on cellular health and function. This research not only contributes to the fundamental understanding of mitochondrial-associated diseases but also holds promise for the development of novel therapeutic approaches to mitigate or prevent the effects of OPA3-related conditions. Through the integration of structural biology, genetics, and cellular biology, the study of OPA3 recombinant protein paves the way for new insights into the pathogenesis of optic neuropathies and broader mitochondrial disorders.











