Cat: PA2000-763DB

Recombinant Human OPA3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    OPA3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    OPA3;Optic atrophy 3 Protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9H6K4

  • Expression Region

    1-179aa

  • AA Sequence

    MVVGAFPMAKLLYLGIRQVSKPLANRIKEAARRSEFFKTYICLPPAQLYH WVEMRTKMRIMGFRGTVIKPLNEEAAAELGAELLGEATIFIVGGGCLVLE YWRHQAQQRHKEEEQRAAWNALRDEVGHLALALEALQAQVQAAPPQGALE ELRTELQEVRAQLCNPGRSASHAVPASKK

  • Molecular Weight

    19.9 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of OPA3 (Optic Atrophy 3) recombinant protein is pivotal in understanding mitochondrial function and its implications for neurodegenerative diseases. OPA3 is a gene located on chromosome 19, and mutations in this gene are associated with autosomal dominant optic atrophy, a condition characterized by vision loss due to the degeneration of the optic nerve. Research has shown that OPA3 plays a critical role in the maintenance of mitochondrial dynamics and function, including processes such as fusion, fission, and apoptosis. Given its significance in mitochondrial biology, OPA3 has garnered attention as a potential target for therapeutic interventions in diseases linked to mitochondrial dysfunction, such as Leber's hereditary optic neuropathy (LHON) and other hereditary optic neuropathies. The recombinant form of OPA3 allows for detailed studies into its structure-function relationship, biochemical properties, and interaction mechanisms with other mitochondrial proteins. By producing this protein in a controlled laboratory setting, researchers can investigate its role at the molecular level, as well as its impact on cellular health and function. This research not only contributes to the fundamental understanding of mitochondrial-associated diseases but also holds promise for the development of novel therapeutic approaches to mitigate or prevent the effects of OPA3-related conditions. Through the integration of structural biology, genetics, and cellular biology, the study of OPA3 recombinant protein paves the way for new insights into the pathogenesis of optic neuropathies and broader mitochondrial disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US