Analytical Data
-
Gene name
PDCD6
- Application
-
Alternative Names
PDCD6;ALG2;Programmed cell death Protein 6
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O75340
-
Expression Region
1-191aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMAAYSYRPGPGAGPGPAAGAALPDQSFLWN VFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGV NFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQF HDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSY EQYLSMVFSIV
-
Molecular Weight
24 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PDCD6, also known as programmed cell death 6, is a highly conserved protein involved in various cellular processes, including apoptosis, calcium signaling, and the regulation of cell survival. It functions by interacting with several binding partners, and its dysregulation has been implicated in various diseases, including cancer and neurodegenerative disorders. Researchers have focused on PDCD6 due to its critical role in cell death pathways and its potential as a therapeutic target. The recombinant expression of PDCD6 allows for the production of large quantities of the protein, facilitating detailed biochemical studies and the exploration of its functions and interactions at the molecular level. This research is particularly significant for understanding the mechanisms of programmed cell death and developing strategies to manipulate these pathways for therapeutic purposes. The ability to produce purified PDCD6 protein also paves the way for structural studies, which may elucidate the conformational changes that occur during its interactions with other cellular proteins. Overall, PDCD6 recombination studies are vital for advancing our knowledge of cellular apoptosis mechanisms and developing novel treatments for diseases characterized by abnormal cell survival or death.
