Analytical Data
-
Gene name
PDCD5
- Application
-
Alternative Names
PDCD5;TFAR19;Programmed cell death Protein 5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O14737-1
-
Expression Region
1-125aa
-
AA Sequence
MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQ SARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVS QQTEKTTTVKFNRRKVMDSDEDDDY
-
Molecular Weight
14 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PDCD5, or Programmed Cell Death 5, is a protein that plays a crucial role in regulating apoptosis and cellular stress responses. Its significance has gained attention in various fields, including cancer research, neurodegenerative diseases, and other conditions associated with dysregulated cell death. PDCD5 interacts with multiple signaling pathways, particularly those involving p53, highlighting its potential as a mediator of tumor suppression and a participant in normal physiological processes such as cell differentiation. Research into PDCD5 recombinant proteins aims to elucidate its functional mechanisms, optimize its use in therapeutic applications, and explore its potential as a biomarker for disease progression. Furthermore, recombinant PDCD5 could facilitate the development of novel therapeutic strategies, including targeted cancer therapies that exploit apoptosis pathways or enhance cellular responses to stress. Overall, studies on PDCD5 and its recombinantly produced variants are vital for understanding the complexities of cell regulation and developing innovative approaches to treat related diseases.
