Analytical Data
-
Gene name
MBNL3
- Application
-
Alternative Names
AI661274; CHCR; Cys3His CCG1 required protein; Cys3His CCG1-required protein; E430034C16Rik; MBLX; MBLX39; MBNL 3; Mbnl3; MBNL3_HUMAN; MBXL; Muscleblind like 3; Muscleblind like protein 3; Muscleblind like splicing regulator 3; Muscleblind like X linked protein; Muscleblind-like protein 3; Muscleblind-like X-linked protein; OTTMUSP00000019072; OTTMUSP00000019073; OTTMUSP00000019074; Protein HCHCR; RP23-98P13.1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NUK0
-
Expression Region
1-258aa
-
AA Sequence
MFAQQMQLMLQNAQMSSLGSFPMTPSIPANPPMAFNPYIPHPGMGLVPAELVPNTPVLIPGNPPLAMPGAVGPKLMRSDKLEVCREFQRGNCTRGENDCRYAHPTDASMIEASDNTVTICMDYIKGRCSREKCKYFHPPAHLQARLKAAHHQMNHSAASAMALQPGTLQLIPKRSALEKPNGATPVFNPTVFHCQQALTNLQLPQPAFIPAGPILCMAPASNIVPMMHGATPTTVSAATTPATSVPFAAPTTGNQLKF
-
Molecular Weight
54.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MBNL3 (Muscleblind-like 3) is a member of the MBNL protein family, which plays a crucial role in RNA metabolism, particularly in splicing regulation and RNA processing. MBNL proteins are known to bind to specific RNA sequences, influencing alternative splicing patterns and thus cellular function and differentiation. The study of MBNL3 is particularly relevant in the context of myotonic dystrophy, a genetic disorder characterized by abnormal splicing patterns of pre-mRNAs, leading to various symptoms including muscle wasting and cardiac issues. Research has revealed that MBNL3 is involved in the regulation of multiple target RNAs, making it a critical factor in the pathology of such diseases. Furthermore, MBNL3's interactions with other proteins and RNA molecules are essential for understanding its functional mechanisms within the cell. Recent advancements in recombinant protein technology have facilitated the production and purification of MBNL3, allowing researchers to explore its structural characteristics and functional dynamics in greater detail. Investigating the properties of MBNL3 through recombinant methods provides insights into its role in development, disease progression, and offers potential avenues for therapeutic intervention in RNA-related disorders. Insights gained from this research can also aid in elucidating the broader implications of MBNL family proteins in post-transcriptional regulation and their involvement in various biological processes. Overall, MBNL3 represents a significant focus within the field of molecular biology, particularly for its implications in disease mechanisms and potential novel therapeutic targets.
