Analytical Data
-
Gene name
PDCD1LG2
- Application
-
Alternative Names
PDCD1LG2;B7DC;CD273;PDCD1L2;Programmed cell death 1 ligand 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BQ51
-
Expression Region
20-220aa
-
AA Sequence
LFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPH RERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLKV KASYRKINTHILKVPETDEVELTCQATGYPLAEVSWPNVSVPANTSHSRT PEGLYQVTSVLRLKPPPGRNFSCVFWNTHVRELTLASIDLQSQMEPRTHP T
-
Molecular Weight
23 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PDCD1LG2, also known as Programmed Cell Death 1 Ligand 2 (PD-L2), is a key immune checkpoint molecule that interacts with the PD-1 receptor on T cells, playing a significant role in regulating immune responses. Its modulation is crucial for maintaining immune tolerance and preventing autoimmunity, but it also has implications in cancer therapy, where tumor cells exploit this pathway to evade immune surveillance. Recent studies have indicated that PDCD1LG2 can influence the efficacy of immune checkpoint inhibitors, making it a target of interest for enhancing anti-tumor immunity. Research has focused on producing recombinant PDCD1LG2 proteins to study their structure and function, as well as to develop therapeutic strategies that can block its interaction with PD-1. Understanding the pathways involved in PDCD1LG2 signaling could provide insights into developing new immunotherapeutic approaches to treat cancers, autoimmune diseases, and inflammatory conditions. The investigation of PDCD1LG2 recombinant proteins also holds the potential for elucidating the underlying mechanisms of T cell regulation and advancing personalized medicine in oncology.











