Analytical Data
-
Gene name
DDTL
- Application
-
Alternative Names
DDTL；D-dopachrome decarboxylase-like Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A6NHG4
-
Expression Region
1-134aa
-
AA Sequence
MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRFPTVLSTSPAAHGGPRCPGEIIEGKKSCLNEEALFIYFI
-
Molecular Weight
21.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DDTL (Double Domain Toxin-Like) recombinant proteins have garnered significant attention in the field of biotechnology and therapeutic development due to their unique structural and functional properties. Originally derived from bacterial toxins, the DDTL family exhibits a dual-domain architecture, which allows for enhanced specificity and potency in various biological applications. Research into DDTL recombinant proteins focuses on their potential uses in targeted therapies, particularly in cancer treatment and antimicrobial applications, where their ability to selectively target and eliminate diseased cells or pathogenic organisms is crucial. Additionally, the modular nature of DDTL proteins enables the incorporation of various functional moieties, facilitating the design of novel therapeutic agents with improved efficacy and reduced side effects. Advances in genetic engineering and protein expression systems have further propelled the study of DDTL proteins, allowing for the efficient production and characterization of these promising molecular entities. Overall, ongoing research aims to elucidate the mechanisms of action, optimize production processes, and explore the therapeutic potential of DDTL recombinants in addressing pressing medical challenges.
