Cat: PA2000-757DB

Recombinant Human FVT1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    FVT1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    FVT1;FVT1;SDR35C1;3-ketodihydrosphingosine reductase

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q06136

  • Expression Region

    26-270aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMKPLALPGAHVVVTGGSSGIGKCIAIECYK QGAFITLVARNEDKLLQAKKEIEMHSINDKQVVLCISVDVSQDYNQVENV IKQAQEKLGPVDMLVNCAGMAVSGKFEDLEVSTFERLMSINYLGSVYPSR AVITTMKERRVGRIVFVSSQAGQLGLFGFTAYSASKFAIRGLAEALQMEV KPYNVYITVAYPPDTDTPGFAEENRTKPLETRLISETTSVCKPEQVAKQI VKDAIQGNFNSSLGSD

  • Molecular Weight

    29 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

FVT1, or fructose transporter 1, is a crucial membrane protein responsible for the transport of fructose across cellular membranes. Its significance has gained attention due to the increasing prevalence of fructose in diets, particularly with the consumption of high-fructose corn syrup in processed foods. Understanding the mechanisms of FVT1 is vital, given its role in metabolic processes and potential implications in conditions such as obesity, diabetes, and metabolic syndrome. Research has shown that dysregulation of fructose transport can lead to excessive fructose accumulation in tissues, contributing to insulin resistance and fatty liver disease. Current studies aim to elucidate the structure-function relationship of FVT1, investigate its regulatory mechanisms, and explore how it interacts with other metabolic pathways. Moreover, modulating its activity could serve as a therapeutic target for managing metabolic disorders. As researchers delve deeper into the molecular characteristics and regulatory networks of FVT1, they aspire to uncover novel insights that could pave the way for innovative approaches to prevent and treat diseases linked to fructose metabolism.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US