Analytical Data
-
Gene name
FVT1
- Application
-
Alternative Names
FVT1；FVT1；SDR35C1；3-ketodihydrosphingosine reductase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q06136
-
Expression Region
26-270aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMKPLALPGAHVVVTGGSSGIGKCIAIECYK QGAFITLVARNEDKLLQAKKEIEMHSINDKQVVLCISVDVSQDYNQVENV IKQAQEKLGPVDMLVNCAGMAVSGKFEDLEVSTFERLMSINYLGSVYPSR AVITTMKERRVGRIVFVSSQAGQLGLFGFTAYSASKFAIRGLAEALQMEV KPYNVYITVAYPPDTDTPGFAEENRTKPLETRLISETTSVCKPEQVAKQI VKDAIQGNFNSSLGSD
-
Molecular Weight
29 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FVT1, or fructose transporter 1, is a crucial membrane protein responsible for the transport of fructose across cellular membranes. Its significance has gained attention due to the increasing prevalence of fructose in diets, particularly with the consumption of high-fructose corn syrup in processed foods. Understanding the mechanisms of FVT1 is vital, given its role in metabolic processes and potential implications in conditions such as obesity, diabetes, and metabolic syndrome. Research has shown that dysregulation of fructose transport can lead to excessive fructose accumulation in tissues, contributing to insulin resistance and fatty liver disease. Current studies aim to elucidate the structure-function relationship of FVT1, investigate its regulatory mechanisms, and explore how it interacts with other metabolic pathways. Moreover, modulating its activity could serve as a therapeutic target for managing metabolic disorders. As researchers delve deeper into the molecular characteristics and regulatory networks of FVT1, they aspire to uncover novel insights that could pave the way for innovative approaches to prevent and treat diseases linked to fructose metabolism.
