Cat: PA2000-5024

Recombinant Human CHRNE Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CHRNE

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CHRNE;ACHRE;Acetylcholine receptor subunit epsilon

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q04844

  • Expression Region

    21-239aa

  • AA Sequence

    KNEELRLYHHLFNNYDPGSRPVREPEDTVTISLKVTLTNLISLNEKEETLTTSVWIGIDWQDYRLNYSKDDFGGIETLRVPSELVWLPEIVLENNIDGQFGVAYDANVLVYEGGSVTWLPPAIYRSVCAVEVTYFPFDWQNCSLIFRSQTYNAEEVEFTFAVDNDGKTINKIDIDTEAYTENGEWAIDFCPGVIRRHHGGATDGPGETDVIYSLIIRRK

  • Molecular Weight

    31.9 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CHRNE, or the cholinergic receptor nicotinic epsilon subunit, is a critical component of the nicotinic acetylcholine receptor (nAChR), which plays a significant role in neuromuscular transmission and neurotransmission in the central nervous system. Research on CHRNE is imperative due to its involvement in various physiological processes, and its implications in several neuromuscular disorders, such as congenital myasthenic syndromes and other autoimmune diseases like myasthenia gravis. Given the importance of nAChRs in mediating excitatory neurotransmission, CHRNE’s structural and functional characteristics are crucial for understanding receptor assembly, ion channel function, and receptor pharmacology. The recombinant expression of CHRNE in various systems, including mammalian cells and yeast, facilitates detailed analysis of its biophysical properties, ligand-binding characteristics, and interaction with other receptor subunits. This research not only advances our understanding of the fundamental biology of nicotinic receptors but also lays the groundwork for the development of targeted therapeutic strategies to treat diseases associated with nAChR dysfunction. Moreover, by investigating the structure and function of CHRNE, researchers aim to identify novel drug targets and improve existing treatment modalities for related neurological and muscular disorders, thereby enhancing therapeutic outcomes for affected patients.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US