Analytical Data
-
Gene name
PCP4L1
- Application
-
Alternative Names
PCP4L1;IQM1;Purkinje cell Protein 4-like Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A6NKN8
-
Expression Region
1-68aa
-
AA Sequence
MGSSHHHHHH SSGLVPRGSH MGSMSELNTKTSPATNQAAGQEEKGKAGNVKKAEEEEEIDIDLTAPETEK AALAIQGKFRRFQKRKKDPSS
-
Molecular Weight
10 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PCP4L1, a member of the Purkinje cell protein family, plays a significant role in cellular signaling pathways, particularly in the nervous system. Its potential involvement in synaptic function and neuronal development has garnered attention in molecular neuroscience. Studies suggest that PCP4L1 may interact with various proteins that are crucial for neurotransmitter release and synaptic plasticity, making it a candidate for understanding neurological disorders. Additionally, its expression patterns indicate a possible role in regulating neuronal excitability and calcium signaling. Researchers are increasingly interested in the recombinant expression of PCP4L1 to dissect its functional properties, examine its interactions with other molecular partners, and investigate its contributions to brain physiology. Furthermore, insights into PCP4L1's structure and function could lead to novel therapeutic strategies for treating neurodevelopmental and neurodegenerative diseases, highlighting the importance of this protein in both basic and applied neuroscience research.
