Cat: PA2000-754DB

Recombinant Human APPBP1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    APPBP1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    APPBP1;APPBP1;NEDD8-activating enzyme E1 regulatory subunit

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q13564

  • Expression Region

    1-534aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMAQLGKLLKEQKYDRQLRLWGDHGQEA LESAHVCLINATATGTEILKNLVLPGIGSFTIIDGNQVSGEDAGNNFFLQ RSSIGKNRAEAAMEFLQELNSDVSGSFVEESPENLLDNDPSFFCRFTVVV ATQLPESTSLRLADVLWNSQIPLLICRTYGLVGYMRIIIKEHPVIESHPD NALEDLRLDKPFPELREHFQSYDLDHMEKKDHSHTPWIVIIAKYLAQWYS ETNGRIPKTYKEKEDFRDLIRQGILKNENGAPEDEENFEEAIKNVNTALN TTQIPSSIEDIFNDDRCINITKQTPSFWILARALKEFVAKEGQGNLPVRG TIPDMIADSGKYIKLQNVYREKAKKDAAAVGNHVAKLLQSIGQAPESISE KELKLLCSNSAFLRVVRCRSLAEEYGLDTINKDEIISSMDNPDNEIVLYL MLRAVDRFHKQQGRYPGVSNYQVEEDIGKLKSCLTGFLQEYGLSVMVKDD YVHEFCRYGAAEPHTIAAFLGGAAAQEVIKIITKQFVIFNNTYIYSGMSQ TSATFQL

  • Molecular Weight

    63 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

APPBP1, or Amyloid-beta Precursor Protein-Binding Protein 1, plays a critical role in cellular processes, particularly in relation to Alzheimer's disease and protein degradation pathways. This protein is involved in the regulation of the ubiquitin-proteasome system, which is essential for maintaining cellular homeostasis by degrading misfolded or damaged proteins. Dysregulation of APPBP1 has been implicated in the accumulation of amyloid-beta peptides, a hallmark of Alzheimer’s pathology. Recent studies have highlighted the significance of APPBP1 in mediating the interaction between the amyloid precursor protein and various signaling molecules, suggesting that it may influence the trajectory of neurodegenerative diseases. Furthermore, the recombinant expression of APPBP1 provides a valuable tool for studying its structural and functional properties, as well as its interactions with other proteins. Understanding the role of APPBP1 at the molecular level can aid in the development of novel therapeutic strategies aimed at modulating its activity and potentially mitigating the effects of Alzheimer's disease. Research on APPBP1 has expanded to investigate its involvement in cancer and other neurodegenerative disorders, marking it as a promising target for drug discovery and therapeutic intervention. The generation of recombinant APPBP1 proteins allows for in-depth biochemical assays, structural studies, and potential high-throughput screening approaches to identify small molecules that can modulate its activity, offering new avenues for disease-modifying therapies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US