Analytical Data
-
Gene name
MBD3L1
- Application
-
Alternative Names
MB3L1_HUMAN; MBD3 like 1 ; MBD3-like protein 1; MBD3L ; Mbd3l1; Methyl CpG binding domain protein 3 like 1; Methyl-CpG-binding domain protein 3-like 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WWY6
-
Expression Region
1-194aa
-
AA Sequence
MAKSSQRKQRDCVNQCKSKPGLSTSIPLRMSSYTFKRPVTRITPHPGNEVRYHQWEESLEKPQQVCWQRRLQGLQAYSSAGELSSTLDLANTLQKLVPSYTGGSLLEDLASGLEHSCPMPHLACSSDAVEIIPAEGVGISQLLCKQFLVTEEDIRKQEGKVKTVRERLAIALIADGLANEAEKVRDQEGCPEKR
-
Molecular Weight
48 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MBD3L1 (Methyl-CpG Binding Domain Protein 3 Like 1) is a member of the MBD protein family, which plays crucial roles in the regulation of gene expression, particularly in the context of epigenetic modifications. Research into MBD3L1 has garnered attention due to its unique function as an epigenetic regulator. Unlike other members of the MBD family, which primarily bind to methylated DNA, MBD3L1's role appears to be more diverse, influencing chromatin structure and gene expression without a strict reliance on DNA methylation. Studies suggest that MBD3L1 may be involved in vital cellular processes such as differentiation and development, indicating its potential implications in various biological contexts and diseases. Furthermore, MBD3L1 has been linked to certain genetic disorders, making it a candidate for understanding the molecular mechanisms behind these conditions. The exploration of MBD3L1 through recombinant protein studies has enabled researchers to elucidate its structure-function relationship and interactions with other nuclear proteins, facilitating a deeper understanding of its role in gene regulation. This ongoing research is crucial for the development of targeted therapeutic strategies aimed at modulating MBD3L1 activity in disease contexts, emphasizing the importance of this protein in both fundamental biology and potential clinical applications.
