Analytical Data
-
Gene name
PCNP
- Application
-
Alternative Names
PCNP;PEST proteolytic signal-containing nuclear Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WW12
-
Expression Region
1-178aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSHMADGKAGDEKPEKSQRAGAAGGPEEE AEKPVKTKTVSSSNGGESSSRSAEKRSAEEEAADLPTKPTKISKFGFAIG SQTTKKASAISIKLGSSKPKETVPTLAPKTLSVAAAFNEDEDSEPEEMPP EAKMRMKNIGRDTPTSAGPNSFNKGKHGFSDNQKLWERNIKSHLGNVHDQ DN
-
Molecular Weight
22 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The research on PCNP (PCNA-associated protein) recombinant proteins has gained considerable attention due to their potential implications in cellular processes such as DNA replication, repair, and cell cycle regulation. PCNP is known to interact with the Proliferating Cell Nuclear Antigen (PCNA), a critical component of the replication machinery, playing a vital role in maintaining genome stability. Studies have indicated that PCNP may influence various cellular pathways, and its dysregulation is associated with several cancers. The production of recombinant PCNP proteins allows researchers to investigate their structural properties and functional roles in detail. Advanced techniques such as protein purification and characterization enable the analysis of PCNP interactions with other nuclear proteins, elucidating its involvement in complex cellular networks. Additionally, understanding the biochemical properties of PCNP can pave the way for developing targeted therapies that could potentially inhibit its function in oncogenic processes. By exploring the mechanisms by which PCNP operates within the cell, this research not only enhances our comprehension of fundamental biological processes but also contributes to the identification of novel therapeutic targets for cancer treatment, underscoring the importance of PCNP as a subject of intricate scientific inquiry.











