Cat: PA1000-2298

Recombinant Human PCMTD1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PCMTD1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PCMTD1;Protein-L-isoaspartate O-methyltransferase domain-containing Protein 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q96MG8

  • Expression Region

    1-220aa

  • AA Sequence

    MGSSHHHHHH SSGLVPRGSH MGSMGGAVSAGEDNDDLIDNLKEAQYIRTERVEQAFRAIDRGDYYLEGYR DNAYKDLAWKHGNIHLSAPCIYSEVMEALKLQPGLSFLNLGSGTGYLSTM VGLILGPFGINHGIELHSDVVEYAKEKLESFIKNSDSFDKFEFCEPAFVV GNCLQIASDSHQYDRIYCGAGVQKDHENYMKILLKVGGILVMPIEDQLTQ IMRTGQNTWESKNILAVSFAPLV

  • Molecular Weight

    27 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PCMTD1 (Protein-L-isoaspartate O-methyltransferase domain-containing protein 1) is a member of the methyltransferase family, implicated in the post-translational modification of proteins. Its primary role is to repair damaged proteins by methylating L-isoaspartate residues, which accumulate due to non-enzymatic reactions that occur over time, particularly under stress conditions. The presence of these non-canonical amino acids can adversely affect protein function, stability, and cellular homeostasis, leading to various diseases, including neurodegenerative disorders and age-related pathologies. Recent studies have highlighted the important function of PCMTD1 in cellular protection mechanisms, demonstrating its potential as both a biomarker for stress-related conditions and a therapeutic target. The exploration of PCMTD1 involves understanding its enzymatic activity, structural features, and regulatory pathways. Additionally, ongoing research aims to delineate its interactions with other proteins and cellular components, which can uncover novel insights into its role in maintaining protein integrity and cellular health. Understanding the molecular mechanisms and biological significance of PCMTD1 is crucial for developing strategies to mitigate protein misfolding and aggregation, thus advancing therapeutic approaches in age-associated diseases and neurodegeneration.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US