Analytical Data
-
Gene name
Opn4
- Application
-
Alternative Names
Opn4；MOP；Melanopsin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UHM6
-
Expression Region
1-478aa
-
AA Sequence
MNPPSGPRVPPSPTQEPSCMATPAPPSWWDSSQSSISSLGRLPSISPTAPGTWAAAWVPLPTVDVPDHAHYTLGTVILLVGLTGMLGNLTVIYTFCRSRSLRTPANMFIINLAVSDFLMSFTQAPVFFTSSLYKQWLFGETGCEFYAFCGALFGISSMITLTAIALDRYLVITRPLATFGVASKRRAAFVLLGVWLYALAWSLPPFFGWSAYVPEGLLTSCSWDYMSFTPAVRAYTMLLCCFVFFLPLLIIIYCYIFIFRAIRETGRALQTFGACKGNGESLWQRQRLQSECKMAKIMLLVILLFVLSWAPYSAVALVAFAGYAHVLTPYMSSVPAVIAKASAIHNPIIYAITHPKYRVAIAQHLPCLGVLLGVSRRHSRPYPSYRSTHRSTLTSHTSNLSWISIRRRQESLGSESEVGWTHMEAAAVWGAAQQANGRSLYGQGLEDLEAKAPPRPQGHEAETPGKTKGLIPSQDPRM
-
Molecular Weight
52.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Opn4, also known as melanopsin, is a photopigment expressed primarily in intrinsically photosensitive retinal ganglion cells (ipRGCs). These cells play a crucial role in the regulation of circadian rhythms and non-image-forming visual functions, such as pupil dilation and the secretion of melatonin. Research on Opn4 has gained significant attention due to its involvement in various physiological processes and its potential implications for understanding light-mediated effects on mood, behavior, and sleep patterns. The study of recombinant Opn4 proteins aims to elucidate the molecular mechanisms of light detection and signaling within the retina. By producing and characterizing these proteins, scientists can investigate the distinct properties of melanopsin, including its spectral sensitivity and response to light stimuli. Furthermore, examining the structural and functional aspects of Opn4 can pave the way for therapeutic interventions in light-related disorders, such as seasonal affective disorder and sleep disturbances. Overall, the research surrounding Opn4 recombinant proteins is integral to advancing our understanding of phototransduction pathways and their broader relevance to human health.
