Analytical Data
-
Gene name
PABPN1
- Application
-
Alternative Names
PABPN1;PAB2;PABP2;Polyadenylate-binding Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q86U42
-
Expression Region
119-306aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSLEAIKARVREMEEEAEKLKELQNEVEK QMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGC GSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVI PKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRG RARATSWYSPY
-
Molecular Weight
24 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PABPN1, or Poly(A)-binding protein nuclear 1, is a crucial protein involved in pre-mRNA processing and maturation, particularly in the polyadenylation of mRNA transcripts. Mutations in the PABPN1 gene have been associated with the onset of oculopharyngeal muscular dystrophy (OPMD), a late-onset genetic disorder characterized by muscle weakness in the eyes and throat. The study of PABPN1 recombinants is vital for understanding the molecular mechanisms underlying these mutations and their implications in disease progression. Research in this area seeks to elucidate the structural and functional properties of PABPN1, examining how specific mutations disrupt the protein's activity, leading to the characteristic symptoms of OPMD. Recombinant PABPN1 proteins provide valuable tools for in vitro studies, enabling researchers to investigate the protein's interactions with other cellular components involved in RNA processing. Furthermore, recombinant technology allows for the detailed analysis of PABPN1's role in the cellular context and its potential as a therapeutic target. By generating and characterizing these recombinant proteins, scientists aim to pave the way for novel strategies to alleviate the symptoms of OPMD and improve our understanding of RNA metabolism in health and disease.











