Cat: PA1000-2272

Recombinant Human PABPN1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PABPN1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PABPN1;PAB2;PABP2;Polyadenylate-binding Protein 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q86U42

  • Expression Region

    119-306aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSLEAIKARVREMEEEAEKLKELQNEVEK QMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGC GSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVI PKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRG RARATSWYSPY

  • Molecular Weight

    24 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PABPN1, or Poly(A)-binding protein nuclear 1, is a crucial protein involved in pre-mRNA processing and maturation, particularly in the polyadenylation of mRNA transcripts. Mutations in the PABPN1 gene have been associated with the onset of oculopharyngeal muscular dystrophy (OPMD), a late-onset genetic disorder characterized by muscle weakness in the eyes and throat. The study of PABPN1 recombinants is vital for understanding the molecular mechanisms underlying these mutations and their implications in disease progression. Research in this area seeks to elucidate the structural and functional properties of PABPN1, examining how specific mutations disrupt the protein's activity, leading to the characteristic symptoms of OPMD. Recombinant PABPN1 proteins provide valuable tools for in vitro studies, enabling researchers to investigate the protein's interactions with other cellular components involved in RNA processing. Furthermore, recombinant technology allows for the detailed analysis of PABPN1's role in the cellular context and its potential as a therapeutic target. By generating and characterizing these recombinant proteins, scientists aim to pave the way for novel strategies to alleviate the symptoms of OPMD and improve our understanding of RNA metabolism in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US