Analytical Data
-
Gene name
PAEP
- Application
-
Alternative Names
PAEP;Glycodelin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P09466
-
Expression Region
1-180aa
-
AA Sequence
MLCLLLTLGVALVCGVPAMDIPQTKQDLELPKLAGTWHSMAMATNNISLM ATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKF KINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEI MQGFIRAFRPLPRHLWYLLDLKQMEEPCRF
-
Molecular Weight
46 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of PAEP (Pregnancy-Associated Endocrine Protein), also known as glycodelin, has gained considerable attention in recent years due to its pivotal role in reproductive biology and potential implications in various pathological conditions. PAEP is a glycoprotein predominantly expressed in the endometrium during pregnancy, where it is involved in regulating immune tolerance, facilitating embryo implantation, and maintaining pregnancy through its immunomodulatory functions. Research has shown that altered levels of PAEP are associated with reproductive disorders, such as infertility and pregnancy complications, including preeclampsia. Beyond reproductive health, PAEP has been implicated in cancer biology, where it may influence tumor growth and metastasis. The production of recombinant PAEP proteins has become a significant avenue of research, enabling scientists to investigate its structural and functional properties in detail. These recombinant forms can be used in various assays to unravel the mechanisms by which PAEP operates in both healthy and pathological contexts. Understanding the biochemical properties and signaling pathways associated with PAEP could lead to the development of novel therapeutic strategies for reproductive health issues and cancer treatment. Thus, ongoing research into PAEP and its recombinant variants continues to be a promising frontier in both reproductive biology and oncology.
