Cat: PA1000-2273

Recombinant Human PAEP Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PAEP

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PAEP;Glycodelin

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P09466

  • Expression Region

    1-180aa

  • AA Sequence

    MLCLLLTLGVALVCGVPAMDIPQTKQDLELPKLAGTWHSMAMATNNISLM ATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKF KINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEI MQGFIRAFRPLPRHLWYLLDLKQMEEPCRF

  • Molecular Weight

    46 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of PAEP (Pregnancy-Associated Endocrine Protein), also known as glycodelin, has gained considerable attention in recent years due to its pivotal role in reproductive biology and potential implications in various pathological conditions. PAEP is a glycoprotein predominantly expressed in the endometrium during pregnancy, where it is involved in regulating immune tolerance, facilitating embryo implantation, and maintaining pregnancy through its immunomodulatory functions. Research has shown that altered levels of PAEP are associated with reproductive disorders, such as infertility and pregnancy complications, including preeclampsia. Beyond reproductive health, PAEP has been implicated in cancer biology, where it may influence tumor growth and metastasis. The production of recombinant PAEP proteins has become a significant avenue of research, enabling scientists to investigate its structural and functional properties in detail. These recombinant forms can be used in various assays to unravel the mechanisms by which PAEP operates in both healthy and pathological contexts. Understanding the biochemical properties and signaling pathways associated with PAEP could lead to the development of novel therapeutic strategies for reproductive health issues and cancer treatment. Thus, ongoing research into PAEP and its recombinant variants continues to be a promising frontier in both reproductive biology and oncology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US