Analytical Data
-
Gene name
OXLD1
- Application
-
Alternative Names
OXLD1;C17orf90;Oxidoreductase-like domain-containing Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5BKU9
-
Expression Region
46-147aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSPGAQAPDGRRKFGTDHVEVGSQAGADG TRPPKASLPPELQPPTNCCMSGCPNCVWVEYADRLLQHFQDGGERALAAL EEHVADENLKAFLRMEIRLHTRCGG
-
Molecular Weight
13 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OXLD1, or oxidized low-density lipoprotein receptor 1, has garnered significant attention in recent years due to its potential role in atherosclerosis and cardiovascular diseases. As an important receptor, OXLD1 is implicated in lipid metabolism, inflammatory responses, and cellular signaling pathways. The receptor is known to mediate the uptake and effects of oxidized low-density lipoproteins (oxLDL), which contribute to the development of atherosclerotic plaques. Research has shown that high levels of oxLDL can promote endothelial dysfunction, inflammation, and subsequent foam cell formation, linking it directly to cardiovascular disease risk. Understanding the function and mechanisms of OXLD1 can provide insights into the pathophysiology of atherosclerosis and may lead to the development of novel therapeutic strategies. Recent studies have focused on the expression and functional characterization of recombinant OXLD1 proteins, enabling scientists to explore receptor interactions, ligand binding affinities, and potential regulatory pathways more effectively. This research is crucial for identifying new biomarkers and targets for intervention in cardiovascular diseases, paving the way for innovative treatments that could mitigate the burden of atherosclerosis and its related complications.
