Analytical Data
-
Gene name
GP2b
- Application
-
Alternative Names
GP2b；GP2B；ITGAB；Integrin alpha-IIb
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0C6Y6
-
Expression Region
2-70aa
-
AA Sequence
GSLWSKISQLFVDAFTEFLVSVVDIAIFLAILFGFTVAGWLLVFLLRVVCSALLRSRSAIHSPELSKVL
-
Molecular Weight
13.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GP2b, a glycoprotein found on the surface of platelets, plays a crucial role in the regulation of platelet aggregation and hemostasis. It is part of the integrin family, specifically the αIIbβ3 integrin, which is essential for platelet function during wound healing and thrombosis. Research on GP2b has gained significant attention due to its implications in cardiovascular diseases and thrombotic disorders. Abnormalities in GP2b expression or function can lead to either excessive bleeding or thrombosis, making it a potential target for therapeutic interventions. Scientists have recognized that understanding the molecular mechanisms that govern GP2b's interactions and signaling pathways can provide insights into developing novel antithrombotic drugs. Furthermore, recombinant GP2b proteins are being studied for their therapeutic applications, including the development of platelet inhibitors or as components in diagnostics for platelet dysfunction. Ongoing studies aim to elucidate the structure-function relationships of GP2b, improve the design of GP2b-based therapies, and enhance our understanding of platelet biology in health and disease.
