Analytical Data
-
Gene name
MAL2
- Application
-
Alternative Names
MAL2; Protein MAL2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q969L2
-
Expression Region
1-176aa
-
AA Sequence
MSAGGASVPPPPNPAVSFPPPRVTLPAGPDILRTYSGAFVCLEILFGGLVWILVASSNVPLPLLQGWVMFVSVTAFFFSLLFLGMFLSGMVAQIDANWNFLDFAYHFTVFVFYFGAFLLEAAATSLHDLHCNTTITGQPLLSDNQYNINVAASIFAFMTTACYGCSLGLALRRWRP
-
Molecular Weight
19.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MAL2 (MAL Protein 2) is a membrane-associated protein that plays a crucial role in various cellular processes, including membrane trafficking, cell signaling, and the regulation of exosome biogenesis. Research has shown that MAL2 is involved in the modulation of different signaling pathways, making it a significant player in cell communication and interaction. Its expression is prominent in immune cells and certain types of cancerous tissues, highlighting its potential role in immune response and tumor progression. The study of MAL2 recombinantly expressed proteins allows researchers to better understand its structure-function relationship, as well as the molecular mechanisms underlying its involvement in physiological and pathological conditions. Recent advancements in recombinant DNA technology have facilitated the production of MAL2 proteins in heterologous systems, enabling detailed characterization through biochemical and biophysical methods. Additionally, investigating MAL2's interactions with other cellular components may provide insights into its function in health and disease, paving the way for potential therapeutic targets in cancer and immunological disorders. As the search for novel biomarkers and drug targets continues, MAL2 remains a focus of interest within the fields of molecular biology and translational medicine.
