Cat: PA1000-2247

Recombinant Human OPTC Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    OPTC

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    OPTC;OPT;Opticin

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9UBM4

  • Expression Region

    20-332aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSASLPRKERKRREEQMPREGDSFEVLPL RNDVLNPDNYGEVIDLSNYEELTDYGDQLPEVKVTSLAPATSISPAKSTT APGTPSSNPTMTRPTTAGLLLSSQPNHGLPTCLVCVCLGSSVYCDDIDLE DIPPLPRRTAYLYARFNRISRIRAEDFKGLTKLKRIDLSNNLISSIDNDA FRLLHALQDLILPENQLEALPVLPSGIEFLDVRLNRLQSSGIQPAAFRAM EKLQFLYLSDNLLDSIPGPLPLSLRSVHLQNNLIETMQRDVFCDPEEHKH TRRQLEDIRLDGNPINLSLFPSAYFCLPRLPIGRFT

  • Molecular Weight

    38 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The research on recombinant Oligosaccharide-Probing Transferase Complex (OPTC) has gained significant attention due to its crucial role in glycoprotein biosynthesis and post-translational modifications. OPTC, an essential enzyme complex in glycosylation pathways, is involved in transferring sugar moieties to specific protein substrates, which is vital for their proper functioning and stability. The study of OPTC is particularly important in the context of various diseases, including cancer and genetic disorders, where glycosylation patterns are often disrupted. Recombinant techniques allow for the production of OPTC in controlled laboratory settings, facilitating detailed investigations into its structure, function, and regulatory mechanisms. Advances in genetic engineering and protein expression systems enable researchers to produce large quantities of functional OPTC, making it possible to explore its interactions with other molecules and its role in cellular processes. Understanding the mechanisms governing OPTC activity may lead to novel therapeutic strategies, including the development of engineered glycoproteins with enhanced therapeutic properties. Furthermore, the findings from OPTC research could contribute to the broader field of glycobiology, providing insights into the complexities of glycan-mediated biological interactions and their implications in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US