Analytical Data
-
Gene name
MAPK1IP1L
- Application
-
Alternative Names
MAPK1IP1L；C14orf32；MAPK-interacting and spindle-stabilizing Protein-like
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NDC0
-
Expression Region
2-245aa
-
AA Sequence
SDEFSLADALPEHSPAKTSAVSNTKPGQPPQGWPGSNPWNNPSAPSSVPSGLPPSATPSTVPFGPAPTGMYPSVPPTGPPPGPPAPFPPSGPSCPPPGGPYPAPTVPGPGPTGPYPTPNMPFPELPRPYGAPTDPAAAGPLGPWGSMSSGPWAPGMGGQYPTPNMPYPSPGPYPAPPPPQAPGAAPPVPWGTVPPGAWGPPAPYPAPTGSYPTPGLYPTPSNPFQVPSGPSGAPPMPGGPHSYH
-
Molecular Weight
53.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MAPK1IP1L (Mitogen-Activated Protein Kinase 1 Interacting Protein 1 Like) is a protein that has garnered significant interest in the field of molecular biology due to its potential role in various cellular processes. It is believed to function as a regulatory modulator in MAPK (Mitogen-Activated Protein Kinase) signaling pathways, which are crucial for cell proliferation, differentiation, and response to stress. MAPK signaling is implicated in numerous diseases, including cancer and neurodegenerative disorders, making MAPK1IP1L a candidate for further research. Previous studies have indicated that MAPK1IP1L may interact with different MAPK pathways, suggesting that it could influence cellular responses under various physiological and pathological conditions. Understanding the structure, function, and interactions of MAPK1IP1L through recombinant protein studies can provide insights into its regulatory mechanisms and potential implications in disease. Moreover, exploring the recombinant expression of MAPK1IP1L could facilitate the development of novel therapeutic strategies by targeting MAPK signaling in pathological contexts. As a result, MAPK1IP1L is a compelling subject of investigation for researchers aiming to unravel the complexities of MAPK-related signaling networks and their impact on human health.
