Cat: PA1000-2244

Recombinant Human OMG Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    OMG

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    OMG;OMGP;Oligodendrocyte-myelin glycoProtein

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P23515

  • Expression Region

    25-417aa

  • AA Sequence

    ICPLQCICTERHRHVDCSGRNLSTLPSGLQENIIHLNLSYNHFTDLHNQL TQYTNLRTLDISNNRLESLPAHLPRSLWNMSAANNNIKLLDKSDTAYQWN LKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDL SNNSLTQILPGTLINLTNLTHLYLHNNKFTFIPDQSFDQLFQLQEITLYN NRWSCDHKQNITYLLKWMMETKAHVIGTPCSTQISSLKEHNMYPTPSGFT SSLFTVSGMQTVDTINSLSVVTQPKVTKIPKQYRTKETTFGATLSKDTTF TSTDKAFVPYPEDTSTETINSHEAAAATLTIHLQDGMVTNTSLTSSTKSS PTPMTLSITSGMPNNFSEMPQQSTTLNLWREETTTNVKTPLPSVEHHHHH H

  • Molecular Weight

    45 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of OMG (Oligodendrocyte Myelin Glycoprotein) recombinant protein has garnered significant attention in the field of neurobiology due to its pivotal role in the central nervous system, particularly concerning myelin formation and repair. OMG is primarily expressed by oligodendrocytes and is crucial for the maintenance of myelin sheaths that insulate nerve fibers, enabling efficient signal transmission. Research has indicated that OMG is implicated in autoimmune demyelinating diseases such as multiple sclerosis, where it may elicit autoantibody responses leading to myelin degradation. Consequently, the production of recombinant OMG protein has become a focus for investigators aiming to understand its structure, function, and potential therapeutic applications. By utilizing recombinant DNA technology, researchers can produce large quantities of OMG protein for functional assays, epitope mapping, and the development of diagnostic tools. Moreover, the characterization of this protein aids in elucidating the molecular mechanisms underlying oligodendrocyte biology and the demyelination process. As the field advances, recombinant OMG protein could serve as a promising candidate for novel therapeutic strategies aimed at remyelination and neuroprotection in demyelinating disorders. Overall, the exploration of OMG and its recombinant forms holds great potential for enhancing our understanding of central nervous system pathologies and developing effective interventions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US