Analytical Data
-
Gene name
MAK3
- Application
-
Alternative Names
AK3; FLJ13194; hNAT5; hSAN; Mak3 homolog (S. cerevisiae); Mak3 homolog; N-acetyltransferase 13 (GCN5-related); N-acetyltransferase 13; N-acetyltransferase 5; N-acetyltransferase san homolog; N-alpha-acetyltransferase 50; N-alpha-acetyltransferase 50; NatE catalytic subunit; Naa50; NAA50_HUMAN; NAT 5; NAT13; NAT5; NatE catalytic subunit; San
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9GZZ1
-
Expression Region
1-169aa
-
AA Sequence
MKGSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNLKVPSGQNADVQKTDN
-
Molecular Weight
46.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MAK3 is a member of the MAK gene family, which has been implicated in various cellular processes, including cell differentiation, proliferation, and apoptosis. Research into MAK3 has gained momentum due to its potential role in cancer biology, where altered expression of MAK genes has been associated with tumorigenesis and metastasis. Recent studies have highlighted the importance of MAK3 in modulating signaling pathways related to cell growth and survival, such as the MAPK and PI3K/Akt pathways. Understanding the precise mechanisms of action and the functional role of MAK3 could provide valuable insights into its potential as a therapeutic target. Furthermore, the development of recombinant MAK3 proteins enables detailed studies of its structure-function relationships, allowing researchers to explore its interactions with other cellular molecules and pathways. This knowledge may pave the way for novel strategies in cancer treatment and beyond, contributing to the broader understanding of how MAK3 influences cellular dynamics.











