Cat: PA2000-9155

Recombinant Human MAK3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MAK3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    AK3; FLJ13194; hNAT5; hSAN; Mak3 homolog (S. cerevisiae); Mak3 homolog; N-acetyltransferase 13 (GCN5-related); N-acetyltransferase 13; N-acetyltransferase 5; N-acetyltransferase san homolog; N-alpha-acetyltransferase 50; N-alpha-acetyltransferase 50; NatE catalytic subunit; Naa50; NAA50_HUMAN; NAT 5; NAT13; NAT5; NatE catalytic subunit; San

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9GZZ1

  • Expression Region

    1-169aa

  • AA Sequence

    MKGSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNLKVPSGQNADVQKTDN

  • Molecular Weight

    46.4 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MAK3 is a member of the MAK gene family, which has been implicated in various cellular processes, including cell differentiation, proliferation, and apoptosis. Research into MAK3 has gained momentum due to its potential role in cancer biology, where altered expression of MAK genes has been associated with tumorigenesis and metastasis. Recent studies have highlighted the importance of MAK3 in modulating signaling pathways related to cell growth and survival, such as the MAPK and PI3K/Akt pathways. Understanding the precise mechanisms of action and the functional role of MAK3 could provide valuable insights into its potential as a therapeutic target. Furthermore, the development of recombinant MAK3 proteins enables detailed studies of its structure-function relationships, allowing researchers to explore its interactions with other cellular molecules and pathways. This knowledge may pave the way for novel strategies in cancer treatment and beyond, contributing to the broader understanding of how MAK3 influences cellular dynamics.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US