Analytical Data
-
Gene name
MAGI2
- Application
-
Alternative Names
Activin receptor interacting protein 1; Acvri1 ; Acvrinp1; ACVRIP1; AIP 1; Aip-1; ARIP1; Atrophin 1 interacting protein 1; Atrophin 1 interacting protein A; Atrophin-1-interacting protein 1; Atrophin-1-interacting protein A; KIAA0705; MAGI-2; MAGI2; MAGI2_HUMAN; Membrane associated guanylate kinase 2; Membrane associated guanylate kinase inverted 2; Membrane associated guanylate kinase WW and PDZ domain containing 2; Membrane associated guanylate kinase WW and PDZ domain containing protein 2; Membrane-associated guanylate kinase; Membrane-associated guanylate kinase inverted 2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q86UL8
-
Expression Region
519-628aa
-
AA Sequence
PANSMVPPLAIMERPPPVMVNGRHNYETYLEYISRTSQSVPDITDRPPHSLHSMPTDGQLDGTYPPPVHDDNVSMASSGATQAELMTLTIVKGAQGFGFTIADSPTGQRV
-
Molecular Weight
37.84 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MAGI2 (Membrane-associated guanylate kinase with inverted orientation 2) is a member of the MAGUK family of scaffold proteins, which play crucial roles in organizing signaling complexes at cell membranes. Initially identified for its involvement in maintaining synaptic integrity and facilitating cell-cell adhesion, MAGI2 has emerged as a key regulator in various biological processes, including cell differentiation, proliferation, and migration. Recent studies have shown that MAGI2 is implicated in several pathological conditions, including cancer, where it may influence tumor progression and metastasis by modulating signaling pathways such as Wnt and EGFR. Its unique structural features, including multiple protein-protein interaction domains, highlight its potential as a versatile molecular hub. Research on MAGI2 recombinant proteins has focused on elucidating its functional mechanisms in cellular contexts, investigating its interactions with various binding partners, and exploring its potential as a therapeutic target. Understanding the role of MAGI2 in cellular signaling and its implications in disease pathology necessitates the development of high-quality recombinant proteins, which can be used in biochemical assays and cell-based studies. This research is critical for developing novel strategies aimed at manipulating MAGI2-related pathways for therapeutic intervention, particularly in cancer and other diseases where MAGI2 plays a significant role.
