Analytical Data
-
Gene name
OLFM1
- Application
-
Alternative Names
OLFM1;NOE1;NOEL1;Noelin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q99784
-
Expression Region
34-135aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSLPTNPEESWQVYSSAQDSEGRCICTVV APQQTMCSRDARTKQLRQLLEKVQNMSQSIEVLDRRTQRDLQYVEKMENQ MKGLESKFKQVEESHKQHLARQFKG
-
Molecular Weight
14 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Olfactory marker protein (OLFM1) is a critical component in the olfactory system, primarily known for its role in the differentiation and maturation of sensory neurons in the olfactory epithelium. Recent studies have highlighted its involvement in various neurological processes and potential implications in neurodevelopmental disorders. The interest in OLFM1 recombinant protein has surged due to its potential as a biomarker for certain diseases and its role in olfactory neurogenesis. Moreover, understanding the structure and function of OLFM1 at a molecular level could provide insights into signaling pathways relevant to neuronal survival and regeneration. Researchers are particularly focused on the protein's interaction with other signaling molecules and its contribution to the maintenance of olfactory sensory functions, which may open avenues for therapeutic strategies in neurological disorders where olfactory dysfunction is a prominent feature. The recombinant production of OLFM1 facilitates detailed studies into its properties, potential applications in regenerative medicine, and the development of diagnostic tools for diseases linked to olfactory impairments. Thus, the exploration of OLFM1 recombinant protein serves as a promising frontier in both basic and translational neuroscience, bridging gaps in our understanding of olfactory biology and its clinical implications.











