Analytical Data
-
Gene name
MAGI1
- Application
-
Alternative Names
AIP 3; AIP-3; AIP3; Atrophin 1 interacting protein 3; Atrophin-1-interacting protein 3; BAI1 associated protein 1; BAI1-associated protein 1; BAIAP 1; BAIAP1; BAP 1; BAP-1; BAP1; Gukmi1; MAGI 1; MAGI-1; MAGI1; MAGI1_HUMAN; MAGI1c; Membrane associated guanylate kinase inverted 1; membrane associated guanylate kinase WW and PDZ domain containing 1; Membrane-associated guanylate kinase; Membrane-associated guanylate kinase inverted 1; TNRC 19; TNRC19; Trinucleotide repeat containing gene 19
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96QZ7
-
Expression Region
761-859aa
-
AA Sequence
SHSTQVLPEFPPAEAQAPDQTDSSGQKKPDPFKIWAQSRSMYENRPMSPSPASGLSKGEREREINSTNFGECPIPDYQEQDIFLWRKETGFGFRILGGN
-
Molecular Weight
36.63 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MAGI1 (Membrane-Associated Guanylate Kinase Inverted 1) is a key scaffold protein that plays a crucial role in organizing signaling complexes at the cell membrane, particularly in neurons and epithelial cells. Its significance has been highlighted in various cellular processes, including cell adhesion, polarity, and synaptic signaling. Abnormal MAGI1 expression has been linked to several diseases, such as cancer, neurological disorders, and cardiovascular diseases, making it a potential therapeutic target. Research on MAGI1 often focuses on its molecular interactions and the downstream effects of these interactions in cellular signaling pathways. Understanding the role of MAGI1 in these processes can provide insights into the mechanisms of disease and identify novel intervention strategies. The study of MAGI1 recombinant protein aims to elucidate its structural and functional properties, allowing for a deeper understanding of its role in health and disease. By producing and characterizing MAGI1 recombinant proteins, researchers can investigate its interactions with other signaling molecules and assess its impact on various cellular functions, paving the way for potential therapeutic applications.
