Analytical Data
-
Gene name
MAGED4B
- Application
-
Alternative Names
MAGED4. KIAA1859. MAGED4A. MAGEE1. MAGED4B
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96JG8
-
Expression Region
1-333aa
-
AA Sequence
MIKDYKKIPIKRADMLKDVIREYDEHFPEIIERATYTLEKKFGIHLKEIDKEEHLYILVCTRDSSARLLGKTKDTPRLSLLLVILGVIFMNGNRASEAVLWEALRKMGLRPGVRHPFLGDLRKLITDDFVKQKNPELREETPLSMAPSWYLEYKKIPNSNPPEYEFLWGLRARHETSKMRVLRFIAQNQNRDPREWKAHFLEAVDDAFKTMDVDMAEEHARAQMRAQMNIGDEALIGRWSWDDIQVELLTWDEDGDFGDAWARIPFAFWARYHQYILNSNRANRRATWRAGVSSGTNGGASTSVLDGPSTSSTIRTRNAARAGASFFSWIQHR
-
Molecular Weight
65.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MAGED4B, or Melanoma Antigen Gene D4B, is a member of the MAGED gene family, which is known for its role in cancer biology and immune response. The study of MAGED4B has gained significant attention due to its potential implications in melanoma and other cancers, where it may contribute to tumorigenesis and immune evasion. Research indicates that MAGED4B could be a target for immunotherapy, as it is expressed in various tumor tissues but has limited expression in normal healthy cells, making it a promising candidate for cancer vaccine development. Moreover, the understanding of the regulation and function of MAGED4B in cancer cells is crucial for identifying its role in tumor progression and the development of resistance to therapies. Recent studies have explored the molecular mechanisms that control MAGED4B expression and its interaction with other oncogenic pathways. The ongoing research aims to elucidate the precise function of MAGED4B and to leverage its unique properties for the development of novel therapeutic strategies, including personalized medicine approaches, to improve outcomes for patients with malignant diseases.
