Analytical Data
-
Gene name
sodA
- Application
-
Alternative Names
sodA;Superoxide dismutase [Mn]
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P00448
-
Expression Region
1-206aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMSYTLPSLPYAYDALEPHFDKQTMEIHHTK HHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHA NHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWA WLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIMGLDVWEHAYYLKFQN RRPDYIKEFWNVVNWDEAAARFAAKK
-
Molecular Weight
25 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SodA, or superoxide dismutase A, is an important enzyme that plays a crucial role in protecting cells from oxidative stress by catalyzing the dismutation of superoxide radicals into oxygen and hydrogen peroxide. This function is particularly vital in aerobic organisms, where the byproducts of respiration can lead to cellular damage if not adequately managed. Research on SodA has gained momentum due to its implications in various biological processes, including aging, neurodegenerative diseases, and the general cellular defense against oxidative damage. Many pathogenic bacteria express SodA as part of their defense mechanism against the host immune response, making it a potential target for developing new antimicrobial therapies. The study of recombinant SodA, produced using genetic engineering techniques, allows researchers to investigate its properties, structure, and activity in detail. This research is essential for understanding the enzyme's role in both fundamental biology and its potential applications in medicine. By elucidating the mechanisms of SodA action and its interactions within cellular systems, scientists hope to develop strategies to enhance oxidative stress resistance in model organisms and explore its potential therapeutic uses in humans.
